PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.15G145100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family B3
Protein Properties Length: 428aa    MW: 49096.9 Da    PI: 9.3648
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.15G145100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B348.21.9e-1518103897
                          -HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
                   B3   8 sdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                          ++ l+++ l++p+kf++++g +   s   tl+ ++ r W v++  r+ +++ ++ +GW eFv    +++g f+vF+++g+s+f+ ++ v+
  Manes.15G145100.1.p  18 PSILQQNKLMIPRKFVRKFGDE--LSGVATLTVPDDRIWLVTI--RQIDQKLWFCNGWHEFVVHYSICTGHFLVFRYEGNSNFSVHMYVL 103
                          56677889***********865..77799**************..**************************************8887775 PP

2B349.67e-16336426498
                          E-..-HHHHTT-EE--HHH.HTT.---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE.. CS
                   B3   4 vltpsdvlksgrlvlpkkfaeeh.ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefel 92 
                          vl  s+  + ++l lp  fa++h +g+   s  ++l+ ++g+ W+v++  + k g+  l++GW eF   ng  egD++vF+l + +++ l
  Manes.15G145100.1.p 336 VLRASYLYRGCILHLPSCFARKHlNGV---SDWIKLQFSDGKLWSVRC--SYKAGGAKLSQGWYEFSMNNGFAEGDVCVFELLNLRDTVL 420
                          6778999999*************8666...3479999***********..66667778***********************986688889 PP

                          EEEEE- CS
                   B3  93 vvkvfr 98 
                          +v+vfr
  Manes.15G145100.1.p 421 KVTVFR 426
                          999998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019362.55E-2110101IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086312.67511104IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.7E-2011101IPR015300DNA-binding pseudobarrel domain
CDDcd100172.65E-1511101No hitNo description
SMARTSM010194.1E-1412106IPR003340B3 DNA binding domain
PfamPF023623.1E-1116101IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.4E-20325426IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.55E-20327426IPR015300DNA-binding pseudobarrel domain
CDDcd100175.15E-18331426No hitNo description
PROSITE profilePS5086313.211333427IPR003340B3 DNA binding domain
SMARTSM010196.6E-9333426IPR003340B3 DNA binding domain
PfamPF023621.3E-13336426IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 428 aa     Download sequence    Send to blast
MSGSKLNKCG YFYRLIVPSI LQQNKLMIPR KFVRKFGDEL SGVATLTVPD DRIWLVTIRQ  60
IDQKLWFCNG WHEFVVHYSI CTGHFLVFRY EGNSNFSVHM YVLEPYRLKD PFTMMKTIKD  120
YSEQHHVFDE IDDGDSVEIL GSSPARVACD HLKPKTFDEH VEPNTTCRNY NLPSPQNLHN  180
EASYHPSGDS VKLQPTVHST QGIGSCTNEL QNSVDDMRLE LSHEKIQEHE KTMRKKLGID  240
EENLDPSNAA DIAKRSREGQ SSAESARKLK IIRRKKQSID PSKRKPTARR NVQGENRSRY  300
YKRASVRKRT VTNEDQERVK TAAAAFESVN PFCRVVLRAS YLYRGCILHL PSCFARKHLN  360
GVSDWIKLQF SDGKLWSVRC SYKAGGAKLS QGWYEFSMNN GFAEGDVCVF ELLNLRDTVL  420
KVTVFRV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4i1k_A3e-5229942715142B3 domain-containing transcription factor VRN
4i1k_B3e-5229942715142B3 domain-containing transcription factor VRN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012072569.11e-141PREDICTED: B3 domain-containing transcription factor VRN1-like
TrEMBLA0A067LFX31e-148A0A067LFX3_JATCU; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF21473485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18990.11e-79B3 family protein